PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G45480.1
Common NameAtGRF9, F17K2.27, F4L23.1, GRF9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GRF
Protein Properties Length: 429aa    MW: 48607.6 Da    PI: 8.1757
Description growth-regulating factor 9
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G45480.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC73.91.8e-2388131245
          WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                  +ep rCrRtDGKkWRCs++vl  +k+CErH+hrgr+rsrk +e+
  AT2G45480.1  88 TEPTRCRRTDGKKWRCSNTVLLFEKYCERHMHRGRKRSRKLVES 131
                  79**************************************9986 PP

2WRC68.21e-21305346143
          WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrksk 43 
                  d+epgrCrRtDGKkWRCs++vl+g+k+C++H+hrg +++++++
  AT2G45480.1 305 DNEPGRCRRTDGKKWRCSKDVLSGQKYCDKHMHRG-MKKKHPV 346
                  68*********************************.5555555 PP

3QLQ45.22.8e-162257237
          QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                 ++ aaQl+++++Q+l+y+y+ a++ vP++L+++i++
  AT2G45480.1 22 WMKAAQLMEFRMQALVYRYIEAGLRVPHHLVVPIWN 57
                 789********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.9E-82157IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166616.9052257IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.9E-92456IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166722.93187131IPR014977WRC domain
PfamPF088791.5E-1989130IPR014977WRC domain
PROSITE profilePS5166721.872305349IPR014977WRC domain
PfamPF088793.8E-18307345IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MQSPKMEQEE VEEERMRNKW PWMKAAQLME FRMQALVYRY IEAGLRVPHH LVVPIWNSLA  60
LSSSSNYNYH SSSLLSNKGV THIDTLETEP TRCRRTDGKK WRCSNTVLLF EKYCERHMHR  120
GRKRSRKLVE SSSEVASSST KYDNTYGLDR YNESQSHLHG TISGSSNAQV VTIASLPSAR  180
SCENVIRPSL VISEFTNKSV SHGRKNMEMS YDDFINEKEA SMCVGVVPLQ GDESKPSVQK  240
FFPEVSDKCL EAAKFSSNRK NDIIARSREW KNMNVNGGLF HGIHFSPDTV LQERGCFRLQ  300
GVETDNEPGR CRRTDGKKWR CSKDVLSGQK YCDKHMHRGM KKKHPVDTTN SHENAGFSPL  360
TVETAVRSVV PCKDGDDQKH SVSVMGITLP RVSDEKSTSS CSTDTTITDT ALRGEDDDEE  420
YLSLFSPGV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1120127GRKRSRKL
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT2G45480
AtGenExpressAT2G45480
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed during the early stages of leaf development and expression decreases with the maturation of the leaf. {ECO:0000269|PubMed:20023165}.
UniprotTISSUE SPECIFICITY: Detected in the shoot apical meristem (SAM) and in young leaf primordium. {ECO:0000269|PubMed:15960617, ECO:0000269|PubMed:21036927}.
Functional Description ? help Back to Top
Source Description
TAIRGrowth regulating factor encoding transcription activator. One of the nine members of a GRF gene family, containing nuclear targeting domain. Involved in leaf development.
UniProtTranscription activator that plays a role in the regulation of cell expansion in leaf and cotyledons tissues. Component of a network formed by miR396, the GRFs and their interacting factors (GIFs) acting in the regulation of meristem function, at least partially through the control of cell proliferation. {ECO:0000269|PubMed:21036927}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G45480.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: microRNA 396 (miR396a or miR396b) negatively regulates growth-regulating factors (GRF1-4 and GRF7-9). {ECO:0000269|PubMed:15200956, ECO:0000269|PubMed:19453503, ECO:0000269|PubMed:20023165}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch Q8S9M3
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G45480
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0746470.0AY074647.1 Arabidopsis thaliana At2g45480/F4L23.1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_850438.20.0growth-regulating factor 9
SwissprotQ8S9M30.0GRF9_ARATH; Growth-regulating factor 9
TrEMBLD7LCJ70.0D7LCJ7_ARALL; At2g45480/F4L23.1
STRINGAT2G45480.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM137602024
Representative plantOGRP1249722
Publications ? help Back to Top
  1. Kim JH,Choi D,Kende H
    The AtGRF family of putative transcription factors is involved in leaf and cotyledon growth in Arabidopsis.
    Plant J., 2003. 36(1): p. 94-104
    [PMID:12974814]
  2. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  3. Jones-Rhoades MW,Bartel DP
    Computational identification of plant microRNAs and their targets, including a stress-induced miRNA.
    Mol. Cell, 2004. 14(6): p. 787-99
    [PMID:15200956]
  4. Kim JH,Kende H
    A transcriptional coactivator, AtGIF1, is involved in regulating leaf growth and morphology in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2004. 101(36): p. 13374-9
    [PMID:15326298]
  5. Horiguchi G,Kim GT,Tsukaya H
    The transcription factor AtGRF5 and the transcription coactivator AN3 regulate cell proliferation in leaf primordia of Arabidopsis thaliana.
    Plant J., 2005. 43(1): p. 68-78
    [PMID:15960617]
  6. Liu D,Song Y,Chen Z,Yu D
    Ectopic expression of miR396 suppresses GRF target gene expression and alters leaf growth in Arabidopsis.
    Physiol Plant, 2009. 136(2): p. 223-36
    [PMID:19453503]
  7. Rodriguez RE, et al.
    Control of cell proliferation in Arabidopsis thaliana by microRNA miR396.
    Development, 2010. 137(1): p. 103-12
    [PMID:20023165]
  8. Wang L, et al.
    miR396-targeted AtGRF transcription factors are required for coordination of cell division and differentiation during leaf development in Arabidopsis.
    J. Exp. Bot., 2011. 62(2): p. 761-73
    [PMID:21036927]
  9. Liang G,He H,Li Y,Wang F,Yu D
    Molecular mechanism of microRNA396 mediating pistil development in Arabidopsis.
    Plant Physiol., 2014. 164(1): p. 249-58
    [PMID:24285851]